Lineage for d2ek3a_ (2ek3 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484287Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2484288Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2484289Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2484294Protein Diphthine synthase, DphB [102684] (3 species)
    diphthamide biosynthesis methyltransferase
  7. 2484300Species Pyrococcus horikoshii [TaxId:53953] [142779] (80 PDB entries)
    Uniprot O58456 1-265
  8. 2484449Domain d2ek3a_: 2ek3 A: [164117]
    automated match to d1vcea1
    complexed with na, sah

Details for d2ek3a_

PDB Entry: 2ek3 (more details), 2.8 Å

PDB Description: Structural study of Project ID PH0725 from Pyrococcus horikoshii OT3 (L3M)
PDB Compounds: (A:) diphthine synthase

SCOPe Domain Sequences for d2ek3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ek3a_ c.90.1.1 (A:) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]}
vmyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsre
dvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavg
itglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtanea
melllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpgk
lhiveaeylveiagapreilrvnv

SCOPe Domain Coordinates for d2ek3a_:

Click to download the PDB-style file with coordinates for d2ek3a_.
(The format of our PDB-style files is described here.)

Timeline for d2ek3a_: