![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
![]() | Protein automated matches [190332] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187155] (9 PDB entries) |
![]() | Domain d2ek1h_: 2ek1 H: [164114] automated match to d2cqpa1 |
PDB Entry: 2ek1 (more details), 2 Å
SCOPe Domain Sequences for d2ek1h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ek1h_ d.58.7.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav idlndrpigsrkvklsgps
Timeline for d2ek1h_: