SCOPe 2.06: Domain d2ek1c1: 2ek1 C:875-949

Lineage for d2ek1c1 (2ek1 C:875-949)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d2ek1c1: 2ek1 C:875-949 [164109]
   Other proteins in same PDB: d2ek1a2, d2ek1b2, d2ek1c2, d2ek1d2, d2ek1e2, d2ek1f2, d2ek1g2, d2ek1h2
   automated match to d2cqpa1

Details for d2ek1c1

PDB Entry: 2ek1, 2 Å

PDB Description: Crystal structure of RNA-binding motif of human rna-binding protein 12

PDB Compounds: (C:) RNA-binding protein 12

SCOPe Domain Sequences for d2ek1c1:

Sequence; same for both SEQRES and ATOM records:

>d2ek1c1 d.58.7.1 (C:875-949) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
idlndrpigsrkvkl

Timeline for d2ek1c1:

• d2ek1c1 first appeared in SCOPe 2.01, called d2ek1c_
  
• d2ek1c1 was called d2ek1c_ in SCOPe 2.05
  
• d2ek1c1 appears in SCOPe 2.07
  
• d2ek1c1 appears in the current release, SCOPe 2.08