Lineage for d2ek1c_ (2ek1 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028381Protein automated matches [190332] (2 species)
    not a true protein
  7. 1028382Species Human (Homo sapiens) [TaxId:9606] [187155] (9 PDB entries)
  8. 1028388Domain d2ek1c_: 2ek1 C: [164109]
    automated match to d2cqpa1

Details for d2ek1c_

PDB Entry: 2ek1 (more details), 2 Å

PDB Description: Crystal structure of RNA-binding motif of human rna-binding protein 12
PDB Compounds: (C:) RNA-binding protein 12

SCOPe Domain Sequences for d2ek1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ek1c_ d.58.7.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
idlndrpigsrkvklsgps

SCOPe Domain Coordinates for d2ek1c_:

Click to download the PDB-style file with coordinates for d2ek1c_.
(The format of our PDB-style files is described here.)

Timeline for d2ek1c_: