SCOPe 2.05: Domain d2ejca_: 2ejc A:

Lineage for d2ejca_ (2ejc A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
   automatically mapped to Pfam PF02569

6. Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [188377] (1 PDB entry)

8. Domain d2ejca_: 2ejc A: [164096]
   automated match to d1v8fa_
   complexed with act, zn

Details for d2ejca_

PDB Entry: 2ejc, 2.4 Å

PDB Description: Crystal Structure Of Pantoate--Beta-Alanine Ligase (panC) From Thermotoga maritima

PDB Compounds: (A:) Pantoate--beta-alanine ligase

SCOPe Domain Sequences for d2ejca_:

Sequence; same for both SEQRES and ATOM records:

>d2ejca_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermotoga maritima [TaxId: 2336]}
mriietieemkkfseemrekkktigfvptmgylheghlslvrraraendvvvvsifvnpt
qfgpnedyeryprdferdrkllekenvdcifhpsveemyppdfstyveetklskhlcgrs
rpghfrgvctvvtklfnivkphrayfgqkdaqqfrvlrrmvrdlnmdvemiecpivrepd
glamssrnvylspeerqqalslyqslkiaenlylngerdaekikeemikhlsrfdkvkid
yveivdeetlepvekidrkvivavaawvgnarlidntilg

Timeline for d2ejca_:

• d2ejca_ first appeared in SCOPe 2.01
  
• d2ejca_ appears in SCOPe 2.04
  
• d2ejca_ appears in SCOPe 2.06
  
• d2ejca_ appears in the current release, SCOPe 2.08