SCOPe 2.01: Domain d2ejaa_: 2eja A:

Lineage for d2ejaa_ (2eja A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.22: UROD/MetE-like [51726] (3 families)

5. Family c.1.22.0: automated matches [191464] (1 protein)
   not a true family

6. Protein automated matches [190717] (2 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [188375] (1 PDB entry)

8. Domain d2ejaa_: 2eja A: [164093]
   automated match to d1jpha_
   complexed with act

Details for d2ejaa_

PDB Entry: 2eja, 1.9 Å

PDB Description: Crystal Structure Of Uroporphyrinogen Decarboxylase From Aquifex aeolicus

PDB Compounds: (A:) Uroporphyrinogen decarboxylase

SCOPe Domain Sequences for d2ejaa_:

Sequence; same for both SEQRES and ATOM records:

>d2ejaa_ c.1.22.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
pkndlllrslrgepigrfpvwlmrqagrympeyrkirnrvknflelcknvdlateisllp
lkilgvdaiiifsdilvpleplgvkvefvegegpklswsgkvsdlkkydpsqnayvyeii
krvkeaqdevpvigfagapftllsylieggaskdfkstklfmwenpkeykrlmdiltetv
laylkeqikagadvvqifdswvnnlsledygeyvypyvnyliselkdfsdtpviyffrgs
ssfidlavdyradalsvdwsvdipelfkiydkgfqgnlepavlyaseevieektlgllrr
ipvktryvfnlghglapdmelekvkylvdlvksfplt

Timeline for d2ejaa_:

• d2ejaa_ is new in SCOPe 2.01-stable
  
• d2ejaa_ appears in SCOPe 2.02
  
• d2ejaa_ appears in the current release, SCOPe 2.08