Lineage for d2ejaa_ (2eja A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840547Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2840594Family c.1.22.0: automated matches [191464] (1 protein)
    not a true family
  6. 2840595Protein automated matches [190717] (5 species)
    not a true protein
  7. 2840596Species Aquifex aeolicus [TaxId:63363] [188375] (1 PDB entry)
  8. 2840597Domain d2ejaa_: 2eja A: [164093]
    automated match to d1jpha_
    complexed with act

Details for d2ejaa_

PDB Entry: 2eja (more details), 1.9 Å

PDB Description: Crystal Structure Of Uroporphyrinogen Decarboxylase From Aquifex aeolicus
PDB Compounds: (A:) Uroporphyrinogen decarboxylase

SCOPe Domain Sequences for d2ejaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ejaa_ c.1.22.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
pkndlllrslrgepigrfpvwlmrqagrympeyrkirnrvknflelcknvdlateisllp
lkilgvdaiiifsdilvpleplgvkvefvegegpklswsgkvsdlkkydpsqnayvyeii
krvkeaqdevpvigfagapftllsylieggaskdfkstklfmwenpkeykrlmdiltetv
laylkeqikagadvvqifdswvnnlsledygeyvypyvnyliselkdfsdtpviyffrgs
ssfidlavdyradalsvdwsvdipelfkiydkgfqgnlepavlyaseevieektlgllrr
ipvktryvfnlghglapdmelekvkylvdlvksfplt

SCOPe Domain Coordinates for d2ejaa_:

Click to download the PDB-style file with coordinates for d2ejaa_.
(The format of our PDB-style files is described here.)

Timeline for d2ejaa_: