Lineage for d2ej5b_ (2ej5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100147Species Geobacillus kaustophilus [TaxId:1462] [187671] (2 PDB entries)
  8. 2100161Domain d2ej5b_: 2ej5 B: [164090]
    automated match to d1duba_

Details for d2ej5b_

PDB Entry: 2ej5 (more details), 2 Å

PDB Description: Crystal structure of GK2038 protein (enoyl-CoA hydratase subunit II) from Geobacillus kaustophilus
PDB Compounds: (B:) Enoyl-CoA hydratase subunit II

SCOPe Domain Sequences for d2ej5b_:

Sequence, based on SEQRES records: (download)

>d2ej5b_ c.14.1.0 (B:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
myetiryevkgqvawltlnrpdqlnafteqmnaevtkalkqagadpnvrcvvitgagraf
cagedlsgvteemdhgdvlrsryapmmkalhhlekpvvaavngaaagagmslalacdfrl
lsekasfapafihvglvpdaghlyylprlvgrakalelavlgekvtaeeaaalglatkvi
plsdweeevkqfaerlsamptkaiglikrllreseettfdrylereaecqriagltsdhr
egvkaffekrkplfqgn

Sequence, based on observed residues (ATOM records): (download)

>d2ej5b_ c.14.1.0 (B:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
myetiryevkgqvawltlnrpdqlnafteqmnaevtkalkqagadpnvrcvvitgagraf
cagedlsdhgdvlrsryapmmkalhhlekpvvaavngaaagagmslalacdfrllsekas
fapafihvglvpdaghlyylprlvgrakalelavlgekvtaeeaaalglatkviplsdwe
eevkqfaerlsamptkaiglikrllreseettfdrylereaecqriagltsdhregvkaf
fekrkplfqgn

SCOPe Domain Coordinates for d2ej5b_:

Click to download the PDB-style file with coordinates for d2ej5b_.
(The format of our PDB-style files is described here.)

Timeline for d2ej5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ej5a_