Lineage for d2eivi_ (2eiv I:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2453552Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2453553Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2453947Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2453948Protein automated matches [190626] (9 species)
    not a true protein
  7. 2454011Species Thermus thermophilus HB8 [TaxId:300852] [187669] (1 PDB entry)
  8. 2454019Domain d2eivi_: 2eiv I: [164066]
    automated match to d1ceva_

Details for d2eivi_

PDB Entry: 2eiv (more details), 2.91 Å

PDB Description: crystal structure of the arginase from thermus thermophilus
PDB Compounds: (I:) arginase

SCOPe Domain Sequences for d2eivi_:

Sequence, based on SEQRES records: (download)

>d2eivi_ c.42.1.0 (I:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ervavvgvpmdlganrrgvdmgpsalryarlleqledlgytvedlgdvpvslarasrrrg
rglayleeiraaalvlkerlaalpegvfpivlggdhslsmgsvagaargrrvgvvwvdah
adfntpetspsgnvhgmplavlsglghprltevfravdpkdvvlvgvrsldpgekrllke
agvrvytmhevdrlgvariaeevlkhlqglplhvsldadvldptlapgvgtpvpggltyr
eahllmeilaesgrvqsldlvevnpildernrtaemlvglalsllgkrif

Sequence, based on observed residues (ATOM records): (download)

>d2eivi_ c.42.1.0 (I:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ervavvgvpmdlgvdmgpsalryarlleqledlgytvedlgdvpvslayleeiraaalvl
kerlaalpegvfpivlggdhslsmgsvagaargrrvgvvwvdahadfntpetssgnvhgm
plavlsglghprltevfravdpkdvvlvgvrsldpgekrllkeagvrvytmhevdrlgva
riaeevlkhlqglplhvsldadvldptlapgvgtpvpggltyreahllmeilaesgrvqs
ldlvevnpildernrtaemlvglalsllgkrif

SCOPe Domain Coordinates for d2eivi_:

Click to download the PDB-style file with coordinates for d2eivi_.
(The format of our PDB-style files is described here.)

Timeline for d2eivi_: