Lineage for d1lis__ (1lis -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.19: Fertilization protein [47081] (1 superfamily) Superfamily a.19.1: Fertilization protein [47082] (1 family) 
Family a.19.1.1: Fertilization protein [47083] (2 proteins) Protein Lysin [47084] (2 species) Species Red abalone (Haliotis rufescens) [TaxId:6454] [47085] (4 PDB entries) 
Domain d1lis__: 1lis - [16406]
Details for d1lis__
PDB Entry: 1lis (more details), 1.9 Å
PDB Description: the crystal structure of a fertilization protein
SCOP Domain Sequences for d1lis__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lis__ a.19.1.1 (-) Lysin {Red abalone (Haliotis rufescens)}
hyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwa
nymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinr
mrpadvpvkym
SCOP Domain Coordinates for d1lis__:
Click to download the PDB-style file with coordinates for d1lis__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lis__:
- d1lis__ appears in SCOP 1.57
- d1lis__ appears in the current release, SCOPe 2.08, called d1lisa_
View in 3D