SCOPe 2.08: Domain d1lisa_: 1lis A:

Lineage for d1lisa_ (1lis A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.19: Fertilization protein [47081] (1 superfamily)
   core: 3 helices; bundle, closed, right-handed twist; up-and-down

4. Superfamily a.19.1: Fertilization protein [47082] (1 family)
   automatically mapped to Pfam PF01303

5. Family a.19.1.1: Fertilization protein [47083] (3 proteins)

6. Protein Lysin [47084] (2 species)

7. Species Red abalone (Haliotis rufescens) [TaxId:6454] [47085] (6 PDB entries)

8. Domain d1lisa_: 1lis A: [16406]

Details for d1lisa_

PDB Entry: 1lis, 1.9 Å

PDB Description: the crystal structure of a fertilization protein

PDB Compounds: (A:) lysin

SCOPe Domain Sequences for d1lisa_:

Sequence; same for both SEQRES and ATOM records:

>d1lisa_ a.19.1.1 (A:) Lysin {Red abalone (Haliotis rufescens) [TaxId: 6454]}
hyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwa
nymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinr
mrpadvpvkym

Timeline for d1lisa_:

• d1lisa_ first appeared (with stable ids) in SCOP 1.55, called d1lis__
  
• d1lisa_ appears in SCOPe 2.07