Lineage for d2eiva_ (2eiv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115695Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2115696Protein automated matches [190626] (8 species)
    not a true protein
  7. 2115759Species Thermus thermophilus HB8 [TaxId:300852] [187669] (1 PDB entry)
  8. 2115760Domain d2eiva_: 2eiv A: [164059]
    automated match to d1ceva_

Details for d2eiva_

PDB Entry: 2eiv (more details), 2.91 Å

PDB Description: crystal structure of the arginase from thermus thermophilus
PDB Compounds: (A:) arginase

SCOPe Domain Sequences for d2eiva_:

Sequence, based on SEQRES records: (download)

>d2eiva_ c.42.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ervavvgvpmdlganrrgvdmgpsalryarlleqledlgytvedlgdvpvslarasrrrg
rglayleeiraaalvlkerlaalpegvfpivlggdhslsmgsvagaargrrvgvvwvdah
adfntpetspsgnvhgmplavlsglghprltevfravdpkdvvlvgvrsldpgekrllke
agvrvytmhevdrlgvariaeevlkhlqglplhvsldadvldptlapgvgtpvpggltyr
eahllmeilaesgrvqsldlvevnpildernrtaemlvglalsllgkrif

Sequence, based on observed residues (ATOM records): (download)

>d2eiva_ c.42.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ervavvgvpmdlgvdmgpsalryarlleqledlgytvedlgdvpvslayleeiraaalvl
kerlaalpegvfpivlggdhslsmgsvagaargrrvgvvwvdahadfntpetssgnvhgm
plavlsglghprltevfravdpkdvvlvgvrsldpgekrllkeagvrvytmhevdrlgva
riaeevlkhlqglplhvsldadvldptlapgvgtpvpggltyreahllmeilaesgrvqs
ldlvevnpildernrtaemlvglalsllgkrif

SCOPe Domain Coordinates for d2eiva_:

Click to download the PDB-style file with coordinates for d2eiva_.
(The format of our PDB-style files is described here.)

Timeline for d2eiva_: