Lineage for d2eird_ (2eir D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876458Species Escherichia coli [TaxId:562] [187670] (4 PDB entries)
  8. 2876467Domain d2eird_: 2eir D: [164056]
    automated match to d1xoaa_
    complexed with cu

Details for d2eird_

PDB Entry: 2eir (more details), 2.5 Å

PDB Description: design of disulfide-linked thioredoxin dimers and multimers through analysis of crystal contacts
PDB Compounds: (D:) Thioredoxin 1

SCOPe Domain Sequences for d2eird_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eird_ c.47.1.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldcnl

SCOPe Domain Coordinates for d2eird_:

Click to download the PDB-style file with coordinates for d2eird_.
(The format of our PDB-style files is described here.)

Timeline for d2eird_: