Lineage for d2eira_ (2eir A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455317Family c.47.1.1: Thioltransferase [52834] (16 protein domains)
  6. 2455611Protein automated matches [190442] (13 species)
    not a true protein
  7. 2455624Species Escherichia coli [TaxId:562] [187670] (4 PDB entries)
  8. 2455630Domain d2eira_: 2eir A: [164053]
    automated match to d1xoaa_
    complexed with cu

Details for d2eira_

PDB Entry: 2eir (more details), 2.5 Å

PDB Description: Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal Contacts
PDB Compounds: (A:) Thioredoxin 1

SCOPe Domain Sequences for d2eira_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eira_ c.47.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldcnl

SCOPe Domain Coordinates for d2eira_:

Click to download the PDB-style file with coordinates for d2eira_.
(The format of our PDB-style files is described here.)

Timeline for d2eira_: