Lineage for d2ehsa_ (2ehs A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993360Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1993361Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1993362Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1993425Protein automated matches [190286] (9 species)
    not a true protein
  7. 1993433Species Aquifex aeolicus [TaxId:224324] [187667] (2 PDB entries)
  8. 1993434Domain d2ehsa_: 2ehs A: [164042]
    automated match to d1acpa_
    complexed with na, zn

Details for d2ehsa_

PDB Entry: 2ehs (more details), 1.3 Å

PDB Description: Crystal structure of acyl carrier protein from Aquifex aeolicus (form 1)
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2ehsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehsa_ a.28.1.1 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
sleervkeiiaeqlgvekekitpeakfvedlgadsldvvelimafeeefgieipdedaek
iqtvgdvinylkekv

SCOPe Domain Coordinates for d2ehsa_:

Click to download the PDB-style file with coordinates for d2ehsa_.
(The format of our PDB-style files is described here.)

Timeline for d2ehsa_: