![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.1: ALDH-like [53721] (6 proteins) |
![]() | Protein automated matches [190401] (5 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187273] (15 PDB entries) |
![]() | Domain d2ehqa_: 2ehq A: [164040] automated match to d1uzba_ complexed with act, mpd, na, nap |
PDB Entry: 2ehq (more details), 1.55 Å
SCOPe Domain Sequences for d2ehqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ehqa_ c.82.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggkdaiivdet adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv gvqpfggfklsgtnaktgaldylrlflemkavaerf
Timeline for d2ehqa_: