SCOPe 2.06: Domain d2ehjb1: 2ehj B:2-208

Lineage for d2ehjb1 (2ehj B:2-208)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (32 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188368] (2 PDB entries)

8. Domain d2ehjb1: 2ehj B:2-208 [164035]
   Other proteins in same PDB: d2ehja2, d2ehjb2, d2ehjc2, d2ehjd2
   automated match to d1i5ea_
   complexed with so4

Details for d2ehjb1

PDB Entry: 2ehj, 2.8 Å

PDB Description: Structure of Uracil phosphoribosyl transferase

PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d2ehjb1:

Sequence; same for both SEQRES and ATOM records:

>d2ehjb1 c.61.1.0 (B:2-208) automated matches {Escherichia coli [TaxId: 562]}
kivevkhplvkhklglmreqdistkrfrelasevgslltyeatadletekvtiegwngpv
eidqikgkkitvvpilraglgmmdgvlenvpsarisvvgmyrneetlepvpyfqklvsni
dermalivdpmlatggsviatidllkkagcssikvlvlvaapegiaalekahpdvelyta
sidqglnehgyiipglgdagdkifgtk

Timeline for d2ehjb1:

• d2ehjb1 first appeared in SCOPe 2.01, called d2ehjb_
  
• d2ehjb1 was called d2ehjb_ in SCOPe 2.05
  
• d2ehjb1 appears in SCOPe 2.07
  
• d2ehjb1 appears in the current release, SCOPe 2.08