SCOPe 2.05: Domain d2ehja_: 2ehj A:

Lineage for d2ehja_ (2ehj A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (25 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188368] (1 PDB entry)

8. Domain d2ehja_: 2ehj A: [164034]
   automated match to d1i5ea_
   complexed with so4

Details for d2ehja_

PDB Entry: 2ehj, 2.8 Å

PDB Description: Structure of Uracil phosphoribosyl transferase

PDB Compounds: (A:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d2ehja_:

Sequence; same for both SEQRES and ATOM records:

>d2ehja_ c.61.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
kkivevkhplvkhklglmreqdistkrfrelasevgslltyeatadletekvtiegwngp
veidqikgkkitvvpilraglgmmdgvlenvpsarisvvgmyrneetlepvpyfqklvsn
idermalivdpmlatggsviatidllkkagcssikvlvlvaapegiaalekahpdvelyt
asidqglnehgyiipglgdagdkifgtk

Timeline for d2ehja_:

• d2ehja_ first appeared in SCOPe 2.01
  
• d2ehja_ appears in SCOPe 2.04
  
• d2ehja_ is called d2ehja1 in SCOPe 2.06
  
• d2ehja_ appears in the current release, SCOPe 2.08, called d2ehja1