Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (25 species) not a true protein |
Species Escherichia coli [TaxId:562] [188368] (1 PDB entry) |
Domain d2ehja_: 2ehj A: [164034] automated match to d1i5ea_ complexed with so4 |
PDB Entry: 2ehj (more details), 2.8 Å
SCOPe Domain Sequences for d2ehja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ehja_ c.61.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} kkivevkhplvkhklglmreqdistkrfrelasevgslltyeatadletekvtiegwngp veidqikgkkitvvpilraglgmmdgvlenvpsarisvvgmyrneetlepvpyfqklvsn idermalivdpmlatggsviatidllkkagcssikvlvlvaapegiaalekahpdvelyt asidqglnehgyiipglgdagdkifgtk
Timeline for d2ehja_: