Lineage for d2ehhd_ (2ehh D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836034Species Aquifex aeolicus [TaxId:63363] [187668] (3 PDB entries)
  8. 2836039Domain d2ehhd_: 2ehh D: [164032]
    automated match to d1xkya1
    complexed with po4

Details for d2ehhd_

PDB Entry: 2ehh (more details), 1.9 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from aquifex aeolicus
PDB Compounds: (D:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2ehhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehhd_ c.1.10.0 (D:) automated matches {Aquifex aeolicus [TaxId: 63363]}
fqgsivalitpfkegevdyealgnliefhvdngtdailvcgttgesptltfeehekvief
avkraagrikviagtggnatheavhltahakevgadgalvvvpyynkptqrglyehfktv
aqevdipiiiynipsrtcveisvdtmfklasecenivaskestpnmdriseivkrlgesf
svlsgddsltlpmmalgakgvisvannvmprevkeliraalegdfrrareihyylhdlfk
vlfietnpipvktacwmlgmcekefrlpltemspenenklrevlkkynlplkn

SCOPe Domain Coordinates for d2ehhd_:

Click to download the PDB-style file with coordinates for d2ehhd_.
(The format of our PDB-style files is described here.)

Timeline for d2ehhd_: