SCOPe 2.05: Domain d2ehhc_: 2ehh C:

Lineage for d2ehhc_ (2ehh C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (63 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [187668] (3 PDB entries)

8. Domain d2ehhc_: 2ehh C: [164031]
   automated match to d1xkya1
   complexed with po4

Details for d2ehhc_

PDB Entry: 2ehh, 1.9 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from aquifex aeolicus

PDB Compounds: (C:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2ehhc_:

Sequence; same for both SEQRES and ATOM records:

>d2ehhc_ c.1.10.0 (C:) automated matches {Aquifex aeolicus [TaxId: 63363]}
fqgsivalitpfkegevdyealgnliefhvdngtdailvcgttgesptltfeehekvief
avkraagrikviagtggnatheavhltahakevgadgalvvvpyynkptqrglyehfktv
aqevdipiiiynipsrtcveisvdtmfklasecenivaskestpnmdriseivkrlgesf
svlsgddsltlpmmalgakgvisvannvmprevkeliraalegdfrrareihyylhdlfk
vlfietnpipvktacwmlgmcekefrlpltemspenenklrevlkkynlplkn

Timeline for d2ehhc_:

• d2ehhc_ first appeared in SCOPe 2.01
  
• d2ehhc_ appears in SCOPe 2.04
  
• d2ehhc_ appears in SCOPe 2.06
  
• d2ehhc_ appears in the current release, SCOPe 2.08