Lineage for d2ehha_ (2ehh A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444650Species Aquifex aeolicus [TaxId:63363] [187668] (3 PDB entries)
  8. 2444653Domain d2ehha_: 2ehh A: [164030]
    automated match to d1xkya1
    complexed with po4

Details for d2ehha_

PDB Entry: 2ehh (more details), 1.9 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from aquifex aeolicus
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2ehha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehha_ c.1.10.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mfqgsivalitpfkegevdyealgnliefhvdngtdailvcgttgesptltfeehekvie
favkraagrikviagtggnatheavhltahakevgadgalvvvpyynkptqrglyehfkt
vaqevdipiiiynipsrtcveisvdtmfklasecenivaskestpnmdriseivkrlges
fsvlsgddsltlpmmalgakgvisvannvmprevkeliraalegdfrrareihyylhdlf
kvlfietnpipvktacwmlgmcekefrlpltemspenenklrevlkkynlplkn

SCOPe Domain Coordinates for d2ehha_:

Click to download the PDB-style file with coordinates for d2ehha_.
(The format of our PDB-style files is described here.)

Timeline for d2ehha_: