SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2eh5b_ (2eh5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142835Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2142836Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2142837Family c.90.1.1: Tetrapyrrole methylase [53791] (8 protein domains)
    Pfam PF00590
  6. 2142842Protein Diphthine synthase, DphB [102684] (3 species)
    diphthamide biosynthesis methyltransferase
  7. 2142848Species Pyrococcus horikoshii [TaxId:53953] [142779] (80 PDB entries)
    Uniprot O58456 1-265
  8. 2142972Domain d2eh5b_: 2eh5 B: [164024]
    automated match to d1vcea1
    complexed with na, sah; mutant

Details for d2eh5b_

PDB Entry: 2eh5 (more details), 2.3 Å

PDB Description: Mutant L184M structure of PH0725 from Pyrococcus horikoshii OT3
PDB Compounds: (B:) diphthine synthase

SCOPe Domain Sequences for d2eh5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eh5b_ c.90.1.1 (B:) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amemllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

SCOPe Domain Coordinates for d2eh5b_:

Click to download the PDB-style file with coordinates for d2eh5b_.
(The format of our PDB-style files is described here.)

Timeline for d2eh5b_: