Lineage for d2egrb_ (2egr B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188470Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2188471Protein automated matches [190143] (36 species)
    not a true protein
  7. 2188472Species Aquifex aeolicus [TaxId:63363] [187664] (3 PDB entries)
  8. 2188476Domain d2egrb_: 2egr B: [164016]
    automated match to d1z54a1

Details for d2egrb_

PDB Entry: 2egr (more details), 1.8 Å

PDB Description: Crystal Structure of Hypothetical Protein(AQ1494) from Aquifex aeolicus
PDB Compounds: (B:) Hypothetical protein aq_1494

SCOPe Domain Sequences for d2egrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2egrb_ d.38.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
pfiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayc
eykkplfyddvfevhlnleelsrftftfsyivfkediavakantkhcmvkngkivsipke
vlevlk

SCOPe Domain Coordinates for d2egrb_:

Click to download the PDB-style file with coordinates for d2egrb_.
(The format of our PDB-style files is described here.)

Timeline for d2egrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2egra_