| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
| Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
| Protein automated matches [190143] (36 species) not a true protein |
| Species Aquifex aeolicus [TaxId:63363] [187664] (3 PDB entries) |
| Domain d2egrb_: 2egr B: [164016] automated match to d1z54a1 |
PDB Entry: 2egr (more details), 1.8 Å
SCOPe Domain Sequences for d2egrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2egrb_ d.38.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
pfiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayc
eykkplfyddvfevhlnleelsrftftfsyivfkediavakantkhcmvkngkivsipke
vlevlk
Timeline for d2egrb_: