SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2egra_ (2egr A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167645Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2167646Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2168382Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2168383Protein automated matches [190143] (36 species)
    not a true protein
  7. 2168384Species Aquifex aeolicus [TaxId:63363] [187664] (3 PDB entries)
  8. 2168387Domain d2egra_: 2egr A: [164015]
    automated match to d1z54a1

Details for d2egra_

PDB Entry: 2egr (more details), 1.8 Å

PDB Description: Crystal Structure of Hypothetical Protein(AQ1494) from Aquifex aeolicus
PDB Compounds: (A:) Hypothetical protein aq_1494

SCOPe Domain Sequences for d2egra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2egra_ d.38.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
pfiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayc
eykkplfyddvfevhlnleelsrftftfsyivfkediavakantkhcmvkngkivsipke
vlevlk

SCOPe Domain Coordinates for d2egra_:

Click to download the PDB-style file with coordinates for d2egra_.
(The format of our PDB-style files is described here.)

Timeline for d2egra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2egrb_