Lineage for d2egla_ (2egl A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1389531Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 1389532Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 1389533Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 1389538Protein Diphthine synthase, DphB [102684] (3 species)
    diphthamide biosynthesis methyltransferase
  7. 1389544Species Pyrococcus horikoshii [TaxId:53953] [142779] (80 PDB entries)
    Uniprot O58456 1-265
  8. 1389555Domain d2egla_: 2egl A: [164013]
    automated match to d1vcea1
    complexed with gol, mes, sah, so4; mutant

Details for d2egla_

PDB Entry: 2egl (more details), 1.8 Å

PDB Description: crystal structure of glu171 to lys mutant of diphthine synthase
PDB Compounds: (A:) diphthine synthase

SCOPe Domain Sequences for d2egla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2egla_ c.90.1.1 (A:) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikakkrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

SCOPe Domain Coordinates for d2egla_:

Click to download the PDB-style file with coordinates for d2egla_.
(The format of our PDB-style files is described here.)

Timeline for d2egla_: