SCOPe 2.05: Domain d2egkb_: 2egk B:

Lineage for d2egkb_ (2egk B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries)

8. Domain d2egkb_: 2egk B: [164010]
   automated match to d1gq5a_
   complexed with po4

Details for d2egkb_

PDB Entry: 2egk, 2.85 Å

PDB Description: crystal structure of tamalin pdz-intrinsic ligand fusion protein

PDB Compounds: (B:) General receptor for phosphoinositides 1-associated scaffold protein

SCOPe Domain Sequences for d2egkb_:

Sequence, based on SEQRES records:

>d2egkb_ b.36.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qrkvltlekgdnqtfgfeiqtyglhhreeqrvemvtfvarvhesspaqlagltpgdtias
vnglnvegirhreivdiikasgnvlrletlygteesql

Sequence, based on observed residues (ATOM records):

>d2egkb_ b.36.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qrkvltlekgdnqtfgfeiqtyglhhvemvtfvarvhesspaqlagltpgdtiasvngln
vegirhreivdiikasgnvlrletlyesql

Timeline for d2egkb_:

• d2egkb_ first appeared in SCOPe 2.01
  
• d2egkb_ appears in SCOPe 2.04
  
• d2egkb_ appears in SCOPe 2.06
  
• d2egkb_ appears in the current release, SCOPe 2.08