Lineage for d2egkb_ (2egk B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312126Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1312127Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1312603Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 1312604Protein automated matches [190436] (4 species)
    not a true protein
  7. 1312717Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (5 PDB entries)
  8. 1312724Domain d2egkb_: 2egk B: [164010]
    automated match to d1gq5a_
    complexed with po4

Details for d2egkb_

PDB Entry: 2egk (more details), 2.85 Å

PDB Description: crystal structure of tamalin pdz-intrinsic ligand fusion protein
PDB Compounds: (B:) General receptor for phosphoinositides 1-associated scaffold protein

SCOPe Domain Sequences for d2egkb_:

Sequence, based on SEQRES records: (download)

>d2egkb_ b.36.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qrkvltlekgdnqtfgfeiqtyglhhreeqrvemvtfvarvhesspaqlagltpgdtias
vnglnvegirhreivdiikasgnvlrletlygteesql

Sequence, based on observed residues (ATOM records): (download)

>d2egkb_ b.36.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qrkvltlekgdnqtfgfeiqtyglhhvemvtfvarvhesspaqlagltpgdtiasvngln
vegirhreivdiikasgnvlrletlyesql

SCOPe Domain Coordinates for d2egkb_:

Click to download the PDB-style file with coordinates for d2egkb_.
(The format of our PDB-style files is described here.)

Timeline for d2egkb_: