Lineage for d1enj__ (1enj -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2040Fold a.18: T4 endonuclease V [47076] (1 superfamily)
  4. 2041Superfamily a.18.1: T4 endonuclease V [47077] (1 family) (S)
  5. 2042Family a.18.1.1: T4 endonuclease V [47078] (1 protein)
  6. 2043Protein T4 endonuclease V [47079] (1 species)
  7. 2044Species Bacteriophage T4 (Escherichia coli) [TaxId:10665] [47080] (5 PDB entries)
  8. 2046Domain d1enj__: 1enj - [16401]

Details for d1enj__

PDB Entry: 1enj (more details), 1.8 Å

PDB Description: crystal structure of a pyrimidine dimer specific excision repair enzyme from bacteriophage t4: refinement at 1.45 angstroms and x-ray analysis of the three active site mutants

SCOP Domain Sequences for d1enj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enj__ a.18.1.1 (-) T4 endonuclease V {Bacteriophage T4 (Escherichia coli)}
trinltlvseladqhlmaeyrqlprvfgavrkhvangkrvrdfkisptfilgaghvtffy
dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
iaqrptwykyygkaiya

SCOP Domain Coordinates for d1enj__:

Click to download the PDB-style file with coordinates for d1enj__.
(The format of our PDB-style files is described here.)

Timeline for d1enj__: