Lineage for d2egia_ (2egi A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902478Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1902479Protein automated matches [190143] (32 species)
    not a true protein
  7. 1902480Species Aquifex aeolicus [TaxId:63363] [187664] (3 PDB entries)
  8. 1902485Domain d2egia_: 2egi A: [163999]
    automated match to d1z54a1
    complexed with gol

Details for d2egia_

PDB Entry: 2egi (more details), 2.3 Å

PDB Description: crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus
PDB Compounds: (A:) Hypothetical protein aq_1494

SCOPe Domain Sequences for d2egia_:

Sequence, based on SEQRES records: (download)

>d2egia_ d.38.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
pfiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayc
eykkplfyddvfevhlnleelsrftftfsyivfkediavakantkhcmvkngkivsipke
vlevlk

Sequence, based on observed residues (ATOM records): (download)

>d2egia_ d.38.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
pfiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayc
eykkplfyddvfevhlnleelsrftftfsyivfkediavakantkhcmvkivsipkevle
vlk

SCOPe Domain Coordinates for d2egia_:

Click to download the PDB-style file with coordinates for d2egia_.
(The format of our PDB-style files is described here.)

Timeline for d2egia_: