![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
![]() | Protein PII (product of glnB) [54915] (8 species) trimer with orthogonal packing of beta-sheets around the threefold axis |
![]() | Species Aquifex aeolicus [TaxId:63363] [188357] (3 PDB entries) |
![]() | Domain d2eg2a_: 2eg2 A: [163990] automated match to d1pila_ complexed with atp, cl |
PDB Entry: 2eg2 (more details), 1.72 Å
SCOPe Domain Sequences for d2eg2a_:
Sequence, based on SEQRES records: (download)
>d2eg2a_ d.58.5.1 (A:) PII (product of glnB) {Aquifex aeolicus [TaxId: 63363]} mkkieaiikpfkldevkdalveigiggmtvtevkgfgqqkghteiyrgteyvidflpkvk ievvvrdedvekvvetivktaqtgrvgdgkifiipvedvirirtgergeqai
>d2eg2a_ d.58.5.1 (A:) PII (product of glnB) {Aquifex aeolicus [TaxId: 63363]} mkkieaiikpfkldevkdalveigiggmtvtevkgfdflpkvkievvvrdedvekvveti vktaqtgrvgdgkifiipvedvirirtgergeqai
Timeline for d2eg2a_: