SCOPe 2.08: Domain d1hp8a_: 1hp8 A:

Lineage for d1hp8a_ (1hp8 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.17: Cysteine alpha-hairpin motif [47071] (1 superfamily)
   core: alpha-hairpin crosslinked with two disulfides

4. Superfamily a.17.1: Cysteine alpha-hairpin motif [47072] (2 families)

5. Family a.17.1.1: p8-MTCP1 [47073] (1 protein)
   automatically mapped to Pfam PF08991

6. Protein p8-MTCP1 [47074] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47075] (2 PDB entries)

8. Domain d1hp8a_: 1hp8 A: [16399]

Details for d1hp8a_

PDB Entry: 1hp8

PDB Description: solution structure of human p8-mtcp1, a cysteine-rich protein encoded by the mtcp1 oncogene,reveals a new alpha-helical assembly motif, nmr, minimized average structure

PDB Compounds: (A:) Cx9C motif-containing protein 4

SCOPe Domain Sequences for d1hp8a_:

Sequence; same for both SEQRES and ATOM records:

>d1hp8a_ a.17.1.1 (A:) p8-MTCP1 {Human (Homo sapiens) [TaxId: 9606]}
mpqkdpcqkqaceiqkclqansymeskcqaviqelrkccaqypkgrsvvcsgfekeeeen
ltrksask

Timeline for d1hp8a_:

• d1hp8a_ first appeared (with stable ids) in SCOP 1.55, called d1hp8__
  
• d1hp8a_ appears in SCOPe 2.07