Class b: All beta proteins [48724] (174 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins) archaeal hexapeptide repeat proteins this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain |
Protein automated matches [190628] (1 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [187665] (1 PDB entry) |
Domain d2eg0b_: 2eg0 B: [163987] automated match to d1xhda_ complexed with mg |
PDB Entry: 2eg0 (more details), 2.42 Å
SCOPe Domain Sequences for d2eg0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eg0b_ b.81.1.5 (B:) automated matches {Geobacillus kaustophilus [TaxId: 1462]} miypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqdn silhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagslv ppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqqq
Timeline for d2eg0b_: