Lineage for d2eg0a_ (2eg0 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962569Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962570Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 962730Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins)
    archaeal hexapeptide repeat proteins
    this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain
  6. 962755Protein automated matches [190628] (1 species)
    not a true protein
  7. 962756Species Geobacillus kaustophilus [TaxId:1462] [187665] (1 PDB entry)
  8. 962757Domain d2eg0a_: 2eg0 A: [163986]
    automated match to d1xhda_
    complexed with mg

Details for d2eg0a_

PDB Entry: 2eg0 (more details), 2.42 Å

PDB Description: Crystal Structure of Hypothetical Protein(GK2848) from Geobacillus kaustophilus
PDB Compounds: (A:) Hypothetical conserved protein

SCOPe Domain Sequences for d2eg0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eg0a_ b.81.1.5 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
miypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqdn
silhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagslv
ppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqq

SCOPe Domain Coordinates for d2eg0a_:

Click to download the PDB-style file with coordinates for d2eg0a_.
(The format of our PDB-style files is described here.)

Timeline for d2eg0a_:

  • d2eg0a_ is new in SCOPe 2.01-stable
  • d2eg0a_ does not appear in SCOPe 2.02