| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein automated matches [190047] (37 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188355] (9 PDB entries) |
| Domain d2efed_: 2efe D: [163982] automated match to d1r2qa_ complexed with gnh |
PDB Entry: 2efe (more details), 2.08 Å
SCOPe Domain Sequences for d2efed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efed_ c.37.1.8 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta
gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl
ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp
Timeline for d2efed_: