SCOPe 2.08: Domain d2efeb_: 2efe B:

Lineage for d2efeb_ (2efe B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188355] (9 PDB entries)

8. Domain d2efeb_: 2efe B: [163981]
   automated match to d1r2qa_
   complexed with gnh

Details for d2efeb_

PDB Entry: 2efe, 2.08 Å

PDB Description: Ara7-GDPNH2/AtVps9a

PDB Compounds: (B:) Small GTP-binding protein-like

SCOPe Domain Sequences for d2efeb_:

Sequence; same for both SEQRES and ATOM records:

>d2efeb_ c.37.1.8 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta
gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl
ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp

Timeline for d2efeb_:

• d2efeb_ first appeared in SCOPe 2.01
  
• d2efeb_ appears in SCOPe 2.07