Lineage for d2ef9a_ (2ef9 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2097923Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 2098120Protein automated matches [190083] (9 species)
    not a true protein
  7. 2098124Species Aquifex aeolicus [TaxId:63363] [187662] (1 PDB entry)
  8. 2098125Domain d2ef9a_: 2ef9 A: [163977]
    automated match to d1pe1a_
    complexed with a5p, pep

Details for d2ef9a_

PDB Entry: 2ef9 (more details), 2 Å

PDB Description: structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d2ef9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ef9a_ c.1.10.4 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
ekflviagmnaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdaptalpls
qlegiieaileirevaskyyeti

SCOPe Domain Coordinates for d2ef9a_:

Click to download the PDB-style file with coordinates for d2ef9a_.
(The format of our PDB-style files is described here.)

Timeline for d2ef9a_: