Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
Protein automated matches [190083] (9 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [187662] (1 PDB entry) |
Domain d2ef9a_: 2ef9 A: [163977] automated match to d1pe1a_ complexed with a5p, pep |
PDB Entry: 2ef9 (more details), 2 Å
SCOPe Domain Sequences for d2ef9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ef9a_ c.1.10.4 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]} ekflviagmnaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdaptalpls qlegiieaileirevaskyyeti
Timeline for d2ef9a_: