Lineage for d2ef6a_ (2ef6 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042802Species Canavalia gladiata [TaxId:3824] [187610] (5 PDB entries)
  8. 2042808Domain d2ef6a_: 2ef6 A: [163973]
    automated match to d1azda_
    complexed with ca, mdm, mn

Details for d2ef6a_

PDB Entry: 2ef6 (more details), 2.1 Å

PDB Description: canavalia gladiata lectin complexed with man1-3man-ome
PDB Compounds: (A:) concanavalin a

SCOPe Domain Sequences for d2ef6a_:

Sequence, based on SEQRES records: (download)

>d2ef6a_ b.29.1.1 (A:) automated matches {Canavalia gladiata [TaxId: 3824]}
adtivaveldtypntdigdpnyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d2ef6a_ b.29.1.1 (A:) automated matches {Canavalia gladiata [TaxId: 3824]}
adtivaveldtypntdigdpnyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
nalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwe
ssavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d2ef6a_:

Click to download the PDB-style file with coordinates for d2ef6a_.
(The format of our PDB-style files is described here.)

Timeline for d2ef6a_: