Lineage for d1d2da_ (1d2d A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534943Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 534944Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 534980Family a.16.1.3: a tRNA synthase domain [47068] (2 proteins)
  6. 534981Protein Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element [47069] (2 species)
  7. 534982Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [47070] (2 PDB entries)
  8. 534983Domain d1d2da_: 1d2d A: [16397]

Details for d1d2da_

PDB Entry: 1d2d (more details)

PDB Description: hamster eprs second repeated element. nmr, 5 structures

SCOP Domain Sequences for d1d2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2da_ a.16.1.3 (A:) Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element {Chinese hamster (Cricetulus griseus)}
mvydkiaaqgevvrklkaekapkakvteavecllslkaeykektgkeyvpglehhh

SCOP Domain Coordinates for d1d2da_:

Click to download the PDB-style file with coordinates for d1d2da_.
(The format of our PDB-style files is described here.)

Timeline for d1d2da_: