| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
| Family a.16.1.3: a tRNA synthase domain [47068] (2 proteins) automatically mapped to Pfam PF00458 |
| Protein Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element [47069] (2 species) |
| Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [47070] (2 PDB entries) |
| Domain d1d2da1: 1d2d A:1-51 [16397] Other proteins in same PDB: d1d2da2 |
PDB Entry: 1d2d (more details)
SCOPe Domain Sequences for d1d2da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2da1 a.16.1.3 (A:1-51) Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
mvydkiaaqgevvrklkaekapkakvteavecllslkaeykektgkeyvpg
Timeline for d1d2da1: