Lineage for d2ef5a_ (2ef5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115695Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2115696Protein automated matches [190626] (8 species)
    not a true protein
  7. 2115772Species Thermus thermophilus [TaxId:274] [187661] (2 PDB entries)
  8. 2115773Domain d2ef5a_: 2ef5 A: [163967]
    automated match to d1ceva_
    complexed with gai, lys, mn

Details for d2ef5a_

PDB Entry: 2ef5 (more details), 2 Å

PDB Description: Crystal structure of the arginase from thermus thermophilus
PDB Compounds: (A:) arginase

SCOPe Domain Sequences for d2ef5a_:

Sequence, based on SEQRES records: (download)

>d2ef5a_ c.42.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
ervavvgvpmdlganrrgvdmgpsalryarlleqledlgytvedlgdvpvslarasrrrg
rglayleeiraaalvlkerlaalpegvfpivlggdhslsmgsvagaargrrvgvvwvdah
adfntpetspsgnvhgmplavlsglghprltevfravdpkdvvlvgvrsldpgekrllke
agvrvytmhevdrlgvariaeevlkhlqglplhvsldadvldptlapgvgtpvpggltyr
eahllmeilaesgrvqsldlvevnpildernrtaemlvglalsllgkrif

Sequence, based on observed residues (ATOM records): (download)

>d2ef5a_ c.42.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
ervavvgvpmdlgvdmgpsalryarlleqledlgytvedlgdvpvslayleeiraaalvl
kerlaalpegvfpivlggdhslsmgsvagaargrrvgvvwvdahadfntpetssgnvhgm
plavlsglghprltevfravdpkdvvlvgvrsldpgekrllkeagvrvytmhevdrlgva
riaeevlkhlqglplhvsldadvldptlapgvgtpvpggltyreahllmeilaesgrvqs
ldlvevnpildernrtaemlvglalsllgkrif

SCOPe Domain Coordinates for d2ef5a_:

Click to download the PDB-style file with coordinates for d2ef5a_.
(The format of our PDB-style files is described here.)

Timeline for d2ef5a_: