Lineage for d2eeya_ (2eey A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029548Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 1029554Family d.58.21.0: automated matches [191458] (1 protein)
    not a true family
  6. 1029555Protein automated matches [190706] (2 species)
    not a true protein
  7. 1029556Species Geobacillus kaustophilus [TaxId:235909] [188366] (1 PDB entry)
  8. 1029557Domain d2eeya_: 2eey A: [163965]
    automated match to d1ekra_

Details for d2eeya_

PDB Entry: 2eey (more details), 1.94 Å

PDB Description: Structure of GK0241 protein from Geobacillus kaustophilus
PDB Compounds: (A:) Molybdopterin biosynthesis

SCOPe Domain Sequences for d2eeya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eeya_ d.58.21.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
ssfthfneqgrakmvdithkedtvrvavaqtsvtvsreiyekmtsnaiekgdvlavaqva
gvmaakktadlipmchplmlkgvdiafawendgeahklvitatvktkgstgvemealtaa
svcaltvydmckaldkgmvigptylvektggksghyrrkt

SCOPe Domain Coordinates for d2eeya_:

Click to download the PDB-style file with coordinates for d2eeya_.
(The format of our PDB-style files is described here.)

Timeline for d2eeya_: