Lineage for d2eeka_ (2eek A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 954551Protein automated matches [190044] (7 species)
    not a true protein
  7. 954555Species Atlantic cod (Gadus morhua) [TaxId:8049] [188345] (1 PDB entry)
  8. 954556Domain d2eeka_: 2eek A: [163960]
    automated match to d1bita_
    complexed with ben, ca, na

Details for d2eeka_

PDB Entry: 2eek (more details), 1.85 Å

PDB Description: Crystal structure of Atlantic cod trypsin complexed with benzamidine
PDB Compounds: (A:) Trypsin-1

SCOPe Domain Sequences for d2eeka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eeka_ b.47.1.2 (A:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
ivggyectkhsqahqvslnsgyhfcggslvskdwvvsaahcyksvlrvrlgehhirvneg
teqyissssvirhpnyssyninndimlikltkpatlnqyvhavalptecaadatmctvsg
wgntmssvadgdklqclslpilshadcansypgmitqsmfcagyleggkdscqgdsggpv
vcngvlqgvvswgygcaerdhpgvyakvcvlsgwvrdtma

SCOPe Domain Coordinates for d2eeka_:

Click to download the PDB-style file with coordinates for d2eeka_.
(The format of our PDB-style files is described here.)

Timeline for d2eeka_: