| Class b: All beta proteins [48724] (180 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
| Protein automated matches [190044] (14 species) not a true protein |
| Species Atlantic cod (Gadus morhua) [TaxId:8049] [188345] (1 PDB entry) |
| Domain d2eeka_: 2eek A: [163960] automated match to d1bita_ complexed with ben, ca, na |
PDB Entry: 2eek (more details), 1.85 Å
SCOPe Domain Sequences for d2eeka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eeka_ b.47.1.2 (A:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
ivggyectkhsqahqvslnsgyhfcggslvskdwvvsaahcyksvlrvrlgehhirvneg
teqyissssvirhpnyssyninndimlikltkpatlnqyvhavalptecaadatmctvsg
wgntmssvadgdklqclslpilshadcansypgmitqsmfcagyleggkdscqgdsggpv
vcngvlqgvvswgygcaerdhpgvyakvcvlsgwvrdtma
Timeline for d2eeka_: