![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.3: a tRNA synthase domain [47068] (2 proteins) automatically mapped to Pfam PF00458 |
![]() | Protein Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element [47069] (2 species) |
![]() | Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [47070] (2 PDB entries) |
![]() | Domain d1r1ba1: 1r1b A:1-51 [16396] Other proteins in same PDB: d1r1ba2 |
PDB Entry: 1r1b (more details)
SCOPe Domain Sequences for d1r1ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r1ba1 a.16.1.3 (A:1-51) Multifunctional Glu-Pro-tRNA synthase (EPRS) second repeated element {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} mvydkiaaqgevvrklkaekapkakvteavecllslkaeykektgkeyvpg
Timeline for d1r1ba1: