![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
![]() | Protein cro lambda repressor [47428] (1 species) the fourth helix is replaced with a beta hairpin 3 helices; folded leaf, opened |
![]() | Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries) |
![]() | Domain d2ecsb_: 2ecs B: [163955] automated match to d1copd_ complexed with act, cl, li, so4; mutant heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
PDB Entry: 2ecs (more details), 1.4 Å
SCOPe Domain Sequences for d2ecsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ecsb_ a.35.1.2 (B:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]} meqritlkdyamrfgqtktakdlgvypssinqaihagrkifltinadgsvyaeevkpfps
Timeline for d2ecsb_: