SCOP 1.69: Domain d1ab3__: 1ab3 -

Lineage for d1ab3__ (1ab3 -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit

6. Protein Ribosomal protein S15 [47065] (2 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (19 PDB entries)

8. Domain d1ab3__: 1ab3 - [16395]

Details for d1ab3__

PDB Entry: 1ab3

PDB Description: ribosomal protein s15 from thermus thermophilus, nmr, 26 structures

SCOP Domain Sequences for d1ab3__:

Sequence; same for both SEQRES and ATOM records:

>d1ab3__ a.16.1.2 (-) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d1ab3__:

• d1ab3__ first appeared (with stable ids) in SCOP 1.55
  
• d1ab3__ appears in SCOP 1.67
  
• d1ab3__ appears in SCOP 1.71
  
• d1ab3__ appears in the current release, SCOPe 2.08, called d1ab3a_