Lineage for d1ab3__ (1ab3 -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) 
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) Protein Ribosomal protein S15 [47065] (2 species) 
Species Thermus thermophilus [TaxId:274] [47067] (14 PDB entries) 
Domain d1ab3__: 1ab3 - [16395]
Details for d1ab3__
PDB Entry: 1ab3 (more details)
PDB Description: ribosomal protein s15 from thermus thermophilus, nmr, 26 structures
SCOP Domain Sequences for d1ab3__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ab3__ a.16.1.2 (-) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg
SCOP Domain Coordinates for d1ab3__:
Click to download the PDB-style file with coordinates for d1ab3__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ab3__:
- d1ab3__ first appeared (with stable ids) in SCOP 1.55
- d1ab3__ appears in SCOP 1.59
- d1ab3__ appears in SCOP 1.63
- d1ab3__ appears in the current release, SCOPe 2.08, called d1ab3a_
View in 3D