SCOPe 2.07: Domain d2ebjb_: 2ebj B:

Lineage for d2ebjb_ (2ebj B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families)

5. Family c.56.4.0: automated matches [191433] (1 protein)
   not a true family

6. Protein automated matches [190623] (6 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187658] (1 PDB entry)

8. Domain d2ebjb_: 2ebj B: [163947]
   automated match to d1iofa_

Details for d2ebjb_

PDB Entry: 2ebj, 1.9 Å

PDB Description: Crystal structure of pyrrolidone carboxyl peptidase from Thermus thermophilus

PDB Compounds: (B:) pyrrolidone carboxyl peptidase

SCOPe Domain Sequences for d2ebjb_:

Sequence; same for both SEQRES and ATOM records:

>d2ebjb_ c.56.4.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
milvtgfepfgslehnpsqalldllpsevdgkplrkavlpvdaealgealedlhregpka
vlhlglaedrpvltlerlavnlldfprpdnrgrvledlpivpggplalparfpvkpvlar
wreagipgrpslsagsylcnqafylslyrlpeevpvgflhlppdetlalkrprpyvplev
qaravrlalehl

Timeline for d2ebjb_:

• d2ebjb_ first appeared in SCOPe 2.01
  
• d2ebjb_ appears in SCOPe 2.06
  
• d2ebjb_ appears in the current release, SCOPe 2.08