Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) |
Family c.56.4.0: automated matches [191433] (1 protein) not a true family |
Protein automated matches [190623] (6 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187658] (1 PDB entry) |
Domain d2ebja_: 2ebj A: [163946] automated match to d1iofa_ |
PDB Entry: 2ebj (more details), 1.9 Å
SCOPe Domain Sequences for d2ebja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebja_ c.56.4.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} milvtgfepfgslehnpsqalldllpsevdgkplrkavlpvdaealgealedlhregpka vlhlglaedrpvltlerlavnlldfprpdnrgrvledlpivpggplalparfpvkpvlar wreagipgrpslsagsylcnqafylslyrlpeevpvgflhlppdetlalkrprpyvplev qaravrlalehl
Timeline for d2ebja_: