SCOP 1.71: Domain d1g1xg_: 1g1x G:

Lineage for d1g1xg_ (1g1x G:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit

6. Protein Ribosomal protein S15 [47065] (2 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (23 PDB entries)

8. Domain d1g1xg_: 1g1x G: [16394]
   Other proteins in same PDB: d1g1xa_, d1g1xc_, d1g1xf_, d1g1xh_

Details for d1g1xg_

PDB Entry: 1g1x, 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna

SCOP Domain Sequences for d1g1xg_:

Sequence; same for both SEQRES and ATOM records:

>d1g1xg_ a.16.1.2 (G:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyreiveklglrg

Timeline for d1g1xg_:

• d1g1xg_ first appeared (with stable ids) in SCOP 1.55
  
• d1g1xg_ appears in SCOP 1.69
  
• d1g1xg_ appears in SCOP 1.73
  
• d1g1xg_ appears in the current release, SCOPe 2.08